PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G055800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 291aa    MW: 32914.5 Da    PI: 7.5005
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G055800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.6e-173784148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+eEde l d++++ G g+W+t +++ g+ R++k+c++rw +yl
  Aqcoe1G055800.1.p 37 RGPWTPEEDEVLSDYIRREGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 84
                       89******************************99************97 PP

2Myb_DNA-binding475.8e-1595135648
                        HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Aqcoe1G055800.1.p  95 PDEEDLILRLHRLLGNR-WALIAGRIP-GRTDNDIKNYWNTHL 135
                        89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-222886IPR009057Homeodomain-like
PROSITE profilePS5129416.6163284IPR017930Myb domain
SuperFamilySSF466893.67E-2834131IPR009057Homeodomain-like
SMARTSM007176.6E-123686IPR001005SANT/Myb domain
PfamPF002492.9E-143784IPR001005SANT/Myb domain
CDDcd001673.61E-93984No hitNo description
PROSITE profilePS5129424.81685139IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2487140IPR009057Homeodomain-like
SMARTSM007172.4E-1389137IPR001005SANT/Myb domain
CDDcd001671.22E-1095135No hitNo description
PfamPF002496.9E-1495135IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MRNPSMASKV TCSSSSPASG STTSKITPCC SKEGLKRGPW TPEEDEVLSD YIRREGEGRW  60
RTLPKRAGLL RCGKSCRLRW MNYLRPSLKR GQIAPDEEDL ILRLHRLLGN RWALIAGRIP  120
GRTDNDIKNY WNTHLSKKLI SQGIDPRTHK PLTPESSSCF RPLAPEPNLN NNNTTNHQRN  180
SPSMDEVSCG GNEDSIKNNT NDHLEGIIDH HQHNNWQNYN ALLALQRTTN EENDEHIGYS  240
TGEDVFSSLL NSWVYDEVFG YSIYGGSINF SQSGFDDECK RFSDHVNKCF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24351395108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2539550.0AC253955.1 Aquilegia coerulea clone COL08-M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268108.11e-94Myb transcription factor
SwissprotQ388503e-79MYB5_ARATH; Transcription repressor MYB5
TrEMBLF6HLE72e-95F6HLE7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g07230.t015e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-78myb domain protein 5